PDE4B Antibody - middle region : HRP

PDE4B Antibody - middle region : HRP
SKU
AVIARP56256_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. This gene encodes a protein that specifically hydrolyzes cAMP. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE4B

Key Reference: Fatemi,S.H., Schizophr. Res. 101 (1-3), 36-49 (2008)

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphodiesterase 4B, cAMP-specific (Phosphodiesterase E4 dunce homolog, Drosophila) EMBL CAI21750.1

Protein Size: 564

Purification: Affinity Purified
More Information
SKU AVIARP56256_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56256_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5142
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×