PDE6A Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes the cyclic-GMP (cGMP)-specific phosphodiesterase 6A alpha subunit, expressed in cells of the retinal rod outer segment. The phosphodiesterase 6 holoenzyme is a heterotrimer composed of an alpha, beta, and two gamma subunits. cGMP is an important regulator of rod cell membrane current, and its dynamic concentration is established by phosphodiesterase 6A cGMP hydrolysis and guanylate cyclase cGMP synthesis. The protein is a subunit of a key phototransduction enzyme and participates in processes of transmission and amplification of the visual signal. Mutations in this gene have been identified as one cause of autosomal recessive retinitis pigmentosa.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human PDE6A

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: YRTRNGIAELATRLFNVHKDAVLEDCLVMPDQEIVFPLDMGIVGHVAHSK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha

Protein Size: 779

Purification: Affinity Purified

• SKU: AVIARP56111_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56111_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5145
• Host: Rabbit