PDE7B Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE7B

Key Reference: Gardner,C., (2000) Biochem. Biophys. Res. Commun. 272 (1), 186-192

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 7B

Protein Size: 450

Purification: Affinity Purified

• SKU: AVIARP55364_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55364_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27115
• Host: Rabbit