PDE8A Antibody - C-terminal region : HRP

PDE8A Antibody - C-terminal region : HRP
SKU
AVIARP57752_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phosphodiesterases (PDEs) regulate the intracellular levels of cAMP and cGMP. These cyclic nucleotides play an important role as second messengers in multiple physiologic processes, including regulation of vascular resistance, cardiac output, visceral motility, immune response, inflammation, neuroplasticity, vision, and reproduction. PDEs comprise a large superfamily of enzymes divided into 10 families. Different PDEs can be distinguished by their structure, tissue expression, localization, substrate specificity, regulation, and sensitivity to PDE inhibitors. Diversity in structure and specificity of function make PDEs promising targets for the pharmacotherapy of diseases modulated by cyclic nucleotide signaling (Hetman et al., MIM 2000).

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PDE8A

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: SSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

Protein Size: 829

Purification: Affinity Purified
More Information
SKU AVIARP57752_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57752_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5151
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×