PDLIM3 Antibody - N-terminal region : Biotin

PDLIM3 Antibody - N-terminal region : Biotin
SKU
AVIARP55067_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PDLIM3 contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, PDLIM3 has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDLIM3

Key Reference: Arola,A.M., (2007) Mol. Genet. Metab. 90 (4), 435-440

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PDZ and LIM domain protein 3

Protein Size: 364

Purification: Affinity Purified
More Information
SKU AVIARP55067_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55067_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27295
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×