PDP2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDP2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial

Protein Size: 529

Purification: Affinity Purified

• SKU: AVIARP57451_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57451_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57546
• Host: Rabbit