PDXDC1 Antibody - N-terminal region : Biotin

PDXDC1 Antibody - N-terminal region : Biotin
SKU
AVIARP55147_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDXDC1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyridoxal-dependent decarboxylase domain-containing protein 1

Protein Size: 788

Purification: Affinity Purified
More Information
SKU AVIARP55147_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55147_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23042
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×