PDXP Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDXP

Key Reference: Gohla,A., (2005) Nat. Cell Biol. 7 (1), 21-29

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyridoxal phosphate phosphatase

Protein Size: 296

Purification: Affinity Purified

• SKU: AVIARP57385_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57385_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57026
• Host: Rabbit