PDYN Antibody - middle region : Biotin

PDYN Antibody - middle region : Biotin
SKU
AVIARP57661_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDYN

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proenkephalin-B

Protein Size: 254

Purification: Affinity Purified
More Information
SKU AVIARP57661_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57661_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5173
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×