Pepd Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pepd splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. It plays an important role in collagen metabolism because of the high level of iminoacids in collagen.

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Xaa-Pro dipeptidase

Protein Size: 493

Purification: Affinity Purified

• SKU: AVIARP56087_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56087_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 18624
• Host: Rabbit