PEX26 Antibody - middle region : HRP

PEX26 Antibody - middle region : HRP
SKU
AVIARP57068_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into pero

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEX26

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peroxisome assembly protein 26

Protein Size: 305

Purification: Affinity Purified
More Information
SKU AVIARP57068_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57068_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55670
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×