PEX5 Antibody - middle region : Biotin

PEX5 Antibody - middle region : Biotin
SKU
AVIARP56102_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEX5

Key Reference: Maynard,E.L. (2007) J. Mol. Biol. 368 (5), 1259-1266

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisomal targeting signal 1 receptor

Protein Size: 631

Purification: Affinity Purified
More Information
SKU AVIARP56102_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56102_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5830
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×