PEX5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEX5

Key Reference: Maynard,E.L. (2007) J. Mol. Biol. 368 (5), 1259-1266

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisomal targeting signal 1 receptor

Protein Size: 631

Purification: Affinity Purified

• SKU: AVIARP56102_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56102_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 5830
• Host: Rabbit