PEX7 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PEX7

Key Reference: Arning,L., (er) J. Mol. Med. (2008) In press

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisomal targeting signal 2 receptor

Protein Size: 323

Purification: Affinity Purified

• SKU: AVIARP56091_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56091_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5191
• Host: Rabbit