PFDN2 Antibody - middle region : FITC

PFDN2 Antibody - middle region : FITC
SKU
AVIARP56735_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PFDN2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: LTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prefoldin subunit 2

Protein Size: 154

Purification: Affinity Purified

Subunit: 2
More Information
SKU AVIARP56735_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56735_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5202
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×