PFKFB3 Antibody - C-terminal region : Biotin

PFKFB3 Antibody - C-terminal region : Biotin
SKU
AVIARP56582_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate (F2,6BP), and a fructose-2,6-biphosphatase activity that catalyzes the degradation of F2,6BP. This protein is required for cell cycle progression and prevention of apoptosis. It functions as a regulator of cyclin-dependent kinase 1, linking glucose metabolism to cell proliferation and survival in tumor cells. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human F263

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: VESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3

Protein Size: 520

Purification: Affinity Purified
More Information
SKU AVIARP56582_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56582_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5209
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×