Pfkfb4 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Pfkfb4 is a synthesis and degradation of fructose 2,6-bisphosphate.

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: RIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4

Protein Size: 453

Purification: Affinity Purified

• SKU: AVIARP56585_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56585_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 270198
• Host: Rabbit