PGM1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose. In most ce

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGM1

Key Reference: Takahara,K., (2007) Am. J. Med. Sci. 334 (6), 421-425

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphoglucomutase-1

Protein Size: 562

Purification: Affinity Purified

• SKU: AVIARP56384_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56384_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5236
• Host: Rabbit