PGM3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGM3

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoacetylglucosamine mutase

Protein Size: 542

Purification: Affinity Purified

• SKU: AVIARP56756_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56756_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5238
• Host: Rabbit