PGM3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PGM3

Key Reference: Woo,S.Y., (2007) J. Biol. Chem. 282 (35), 25604-25612

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoacetylglucosamine mutase

Protein Size: 542

Purification: Affinity Purified

• SKU: AVIARP56755_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56755_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5238
• Host: Rabbit