PH-4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and m

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PH-4

Key Reference: Koivunen,P., (2007) J. Biol. Chem. 282 (42), 30544-30552

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transmembrane prolyl 4-hydroxylase

Protein Size: 502

Purification: Affinity Purified

• SKU: AVIARP57763_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57763_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54681
• Host: Rabbit