PHGDH Antibody - middle region : FITC

PHGDH Antibody - middle region : FITC
SKU
AVIARP54801_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: 3-Phosphoglycerate dehydrogenase (PHGDH) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHGDH

Key Reference: Tsang,H.T., (2006) Genomics 88 (3), 333-346

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: D-3-phosphoglycerate dehydrogenase

Protein Size: 533

Purification: Affinity Purified
More Information
SKU AVIARP54801_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54801_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26227
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×