PHLDA1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA1

Key Reference: Nagai,M.A., (2007) Breast Cancer Res. Treat. 106 (1), 49-56

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pleckstrin homology-like domain family A member 1

Protein Size: 401

Purification: Affinity Purified

• SKU: AVIARP54809_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54809_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22822
• Host: Rabbit