Phpt1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Phpt1 exhibits phosphohistidine phosphatase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Phpt1

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: DCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 14 kDa phosphohistidine phosphatase

Protein Size: 124

Purification: Affinity Purified

• SKU: AVIARP54984_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54984_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 75454
• Host: Rabbit