PI16 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI16

Key Reference: Reeves,J.R., Clin. Cancer Res. 12 (20 PT 1), 6018-6022 (2006)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidase inhibitor 16

Protein Size: 463

Purification: Affinity Purified

• SKU: AVIARP55590_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55590_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 221476
• Host: Rabbit