PIDD1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-containing protein (MADD), and thus may function as an adaptor protein in cell death-related signaling processes. The expression of the mouse counterpart of this gene has been found to be positively regulated by the tumor suppressor p53 and to induce cell apoptosis in response to DNA damage, which suggests a role for this gene as an effector of p53-dependent apoptosis. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRDD

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: p53-induced death domain-containing protein 1

Protein Size: 753

Purification: Affinity Purified

• SKU: AVIARP57269_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57269_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55367
• Host: Rabbit