PIK3R4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein can regulate subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R4

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 153kDa

Peptide Sequence: Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphoinositide 3-kinase regulatory subunit 4

Protein Size: 1358

Purification: Affinity Purified

Subunit: 4

• SKU: AVIARP55087_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55087_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 30849
• Host: Rabbit