PIP4K2A Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encode

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIP4K2A

Key Reference: Loughney,K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha

Protein Size: 406

Purification: Affinity Purified

• SKU: AVIARP56620_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56620_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5305
• Host: Rabbit