PIP4K2A Antibody - N-terminal region : FITC

PIP4K2A Antibody - N-terminal region : FITC
SKU
AVIARP56620_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encode

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIP4K2A

Key Reference: Loughney,K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha

Protein Size: 406

Purification: Affinity Purified
More Information
SKU AVIARP56620_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56620_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5305
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×