PIWIL2 Antibody : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL2

Key Reference: Lee,J.H., (2006) Hum. Mol. Genet. 15 (2), 201-211

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Piwi-like protein 2

Protein Size: 973

Purification: Affinity Purified

• SKU: AVIARP57108_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57108_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55124
• Host: Rabbit