PKM2 Antibody - middle region : FITC

PKM2 Antibody - middle region : FITC
SKU
AVIARP57789_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PKM2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyruvate kinase isozymes M1/M2

Protein Size: 531

Purification: Affinity Purified
More Information
SKU AVIARP57789_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57789_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5315
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×