PLCB1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLCB1

Key Reference: Fantuzzi,L., (2008) Blood 111 (7), 3355-3363

Molecular Weight: 134kDa

Peptide Sequence: Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Protein Size: 1173

Purification: Affinity Purified

• SKU: AVIARP55844_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55844_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23236
• Host: Rabbit