PLCD1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLCD1

Key Reference: Fu,L., (2007) Cancer Res. 67 (22), 10720-10726

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1

Protein Size: 756

Purification: Affinity Purified

• SKU: AVIARP56690_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56690_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5333
• Host: Rabbit