PLEKHA1 Antibody - N-terminal region : HRP

PLEKHA1 Antibody - N-terminal region : HRP
SKU
AVIARP57544_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PLEKHA1 binds specifically to phosphatidylinositol-3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. PLEKHA1 may recruit other proteins to the plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHA1

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pleckstrin homology domain-containing family A member 1

Protein Size: 404

Purification: Affinity Purified
More Information
SKU AVIARP57544_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57544_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 59338
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×