PLPP6 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPAPDC2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: FPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: phospholipid phosphatase 6

Protein Size: 295

Purification: Affinity Purified

• SKU: AVIARP55974_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55974_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 403313
• Host: Rabbit