PLPP6 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPAPDC2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: phospholipid phosphatase 6

Protein Size: 295

Purification: Affinity Purified

• SKU: AVIARP55973_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55973_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 403313
• Host: Rabbit