PLS3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLS3

Key Reference: Oprea,G.E., (2008) Science 320 (5875), 524-527

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plastin-3

Protein Size: 630

Purification: Affinity Purified

• SKU: AVIARP56623_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56623_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5358
• Host: Rabbit