PLSCR1 Antibody - N-terminal region : FITC

PLSCR1 Antibody - N-terminal region : FITC
SKU
AVIARP57514_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholipid scramblase 1

Protein Size: 318

Purification: Affinity Purified
More Information
SKU AVIARP57514_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57514_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5359
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×