PLXNA4 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This protein mediates semaphorin receptor activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLXNA4

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plexin A4, B, isoform CRA_a EMBL EAW83793.1

Protein Size: 522

Purification: Affinity Purified

• SKU: AVIARP58514_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58514_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Yeast
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 91584
• Host: Rabbit