PMS2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.This gene is one of the PMS2 gene family members found in clusters on chromosome 7. The product of this gene is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors. Alternatively spliced transcript variants have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PMS2

Key Reference: Jackson,C.C., (2008) Pediatr Blood Cancer 50 (6), 1268-1270

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mismatch repair endonuclease PMS2

Protein Size: 862

Purification: Affinity Purified

• SKU: AVIARP56117_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56117_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5395
• Host: Rabbit