PNMA3 Antibody - N-terminal region : Biotin

PNMA3 Antibody - N-terminal region : Biotin
SKU
AVIARP54945_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNMA3

Key Reference: Wills,N.M., (2006) J. Biol. Chem. 281 (11), 7082-7088

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Paraneoplastic antigen Ma3

Protein Size: 463

Purification: Affinity Purified
More Information
SKU AVIARP54945_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54945_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29944
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×