PNMA8A Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNMAL1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: paraneoplastic antigen-like protein 8A

Protein Size: 439

Purification: Affinity Purified

• SKU: AVIARP57154_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57154_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55228
• Host: Rabbit