PNPLA8 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNPLA8

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-independent phospholipase A2-gamma

Protein Size: 782

Purification: Affinity Purified

• SKU: AVIARP56759_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56759_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 50640
• Host: Rabbit