Pnrc2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pnrc2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. It may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. It is required for UPF1/RENT1 localization to the P-body.It also acts as a nuclear receptor coactivator. It may play a role in controlling the energy balance between energy storage and energy expenditure.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proline-rich nuclear receptor coactivator 2

Protein Size: 134

Purification: Affinity Purified

• SKU: AVIARP57027_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57027_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 100125373
• Host: Rabbit