POLE3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POLE3

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase epsilon subunit 3

Protein Size: 147

Purification: Affinity Purified

Subunit: 3

• SKU: AVIARP58048_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58048_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54107
• Host: Rabbit