POLL Antibody - middle region : Biotin

POLL Antibody - middle region : Biotin
SKU
AVIARP54923_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a DNA polymerase. DNA polymerases catalyze DNA-template-directed extension of the 3'-end of a DNA strand. This particular polymerase, which is a member of the X family of DNA polymerases, likely plays a role in non-homologous end joining and other DNA repair processes. Alternatively spliced transcript variants have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLL

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase lambda

Protein Size: 248

Purification: Affinity Purified
More Information
SKU AVIARP54923_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54923_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27343
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×