POLM Antibody - middle region : Biotin

POLM Antibody - middle region : Biotin
SKU
AVIARP54928_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLM

Key Reference: Juarez,R., (2006) Nucleic Acids Res. 34 (16), 4572-4582

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA-directed DNA/RNA polymerase mu

Protein Size: 494

Purification: Affinity Purified
More Information
SKU AVIARP54928_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54928_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27434
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×