POLR1E Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POLR1E

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA-directed RNA polymerase I subunit RPA49

Protein Size: 419

Purification: Affinity Purified

Subunit: RPA49

• SKU: AVIARP57639_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57639_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64425
• Host: Rabbit