POLR2C Antibody - C-terminal region : HRP

POLR2C Antibody - C-terminal region : HRP
SKU
AVIARP57690_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes the third largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a cysteine rich region and exists as a heterodimer with another polymerase subunit, POLR2J. These two subunits form a core subassembly unit of the polymerase. A pseudogene has been identified on chromosome 21.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse POLR2C

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA-directed RNA polymerase II subunit RPB3

Protein Size: 332

Purification: Affinity Purified
More Information
SKU AVIARP57690_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57690_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5432
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×