POT1 Antibody - middle region : FITC

POT1 Antibody - middle region : FITC
SKU
AVIARP58317_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintenance. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Increased transcriptional expression of this gene is associated with stomach carcinogenesis and its progression. Alternatively spliced transcript variants have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POT1

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: MNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTAN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protection of telomeres protein 1

Protein Size: 634

Purification: Affinity Purified
More Information
SKU AVIARP58317_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58317_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25913
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×